USH1G polyclonal antibody
  • USH1G polyclonal antibody

USH1G polyclonal antibody

Ref: AB-PAB21685
USH1G polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant USH1G.
Información adicional
Size 100 uL
Gene Name USH1G
Gene Alias ANKS4A|FLJ33924|SANS
Gene Description Usher syndrome 1G (autosomal recessive)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NIWCLDNDYHTPLDMAAMKGHMECVRYLDSIAAKQSSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMER
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human USH1G.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 124590
Iso type IgG

Enviar uma mensagem


USH1G polyclonal antibody

USH1G polyclonal antibody