USH1G polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant USH1G.

AB-PAB21685

New product

USH1G polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name USH1G
Gene Alias ANKS4A|FLJ33924|SANS
Gene Description Usher syndrome 1G (autosomal recessive)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NIWCLDNDYHTPLDMAAMKGHMECVRYLDSIAAKQSSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMER
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human USH1G.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 124590
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant USH1G.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant USH1G.

Rabbit polyclonal antibody raised against recombinant USH1G.