PPP1R42 polyclonal antibody
  • PPP1R42 polyclonal antibody

PPP1R42 polyclonal antibody

Ref: AB-PAB21680
PPP1R42 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPP1R42.
Información adicional
Size 100 uL
Gene Name PPP1R42
Gene Alias LRRC67|TLLR|dtr
Gene Description protein phosphatase 1, regulatory subunit 42
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HSLAKSLCILNISNNNIDDITDLELLENLNQLIAVDNQLLHVKDLEFLLNKLMKLWKIDLNGNPVCLKPKYRDRLILVSKSLGT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPP1R42.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 286187
Iso type IgG

Enviar uma mensagem


PPP1R42 polyclonal antibody

PPP1R42 polyclonal antibody