WDR91 polyclonal antibody
  • WDR91 polyclonal antibody

WDR91 polyclonal antibody

Ref: AB-PAB21670
WDR91 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WDR91.
Información adicional
Size 100 uL
Gene Name WDR91
Gene Alias HSPC049
Gene Description WD repeat domain 91
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YDTEAKKNLCEININDNMPRILSLACSPNGASFVCSAAAPSLTSQVDFSAPDIGSKGMNQVPGRLLLWDTKTMKQQLQFSLDPEPIAINCTAFNHNGNLL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WDR91.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29062
Iso type IgG

Enviar uma mensagem


WDR91 polyclonal antibody

WDR91 polyclonal antibody