ARMC7 polyclonal antibody
  • ARMC7 polyclonal antibody

ARMC7 polyclonal antibody

Ref: AB-PAB21666
ARMC7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARMC7.
Información adicional
Size 100 uL
Gene Name ARMC7
Gene Alias FLJ22160
Gene Description armadillo repeat containing 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARMC7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79637
Iso type IgG

Enviar uma mensagem


ARMC7 polyclonal antibody

ARMC7 polyclonal antibody