KIAA1107 polyclonal antibody
  • KIAA1107 polyclonal antibody

KIAA1107 polyclonal antibody

Ref: AB-PAB21664
KIAA1107 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1107.
Información adicional
Size 100 uL
Gene Name KIAA1107
Gene Alias -
Gene Description KIAA1107
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AKLDHNTTTEKQAPKRKMVKQVHTALPKVNAKIVAMPKNLNQSKKGETLNNKDSKQKMPPGQVISKTQPSSQRPLKHETSTVQKSMFHDVRDNNNKD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1107.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23285
Iso type IgG

Enviar uma mensagem


KIAA1107 polyclonal antibody

KIAA1107 polyclonal antibody