PUS7 polyclonal antibody
  • PUS7 polyclonal antibody

PUS7 polyclonal antibody

Ref: AB-PAB21649
PUS7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PUS7.
Información adicional
Size 100 uL
Gene Name PUS7
Gene Alias FLJ20485|KIAA1897|MGC17720
Gene Description pseudouridylate synthase 7 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PGFDVIYPKHKIQEAYREMLTADNLDIDNMRHKIRDYSLSGAYRKIIIRPQNVSWEVVAYDDPKIPLFNTDVDNLEGKTPPVFASEGKYRALKMDFSLPPSTYATMAIREVLKMDTSIKNQTQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PUS7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54517
Iso type IgG

Enviar uma mensagem


PUS7 polyclonal antibody

PUS7 polyclonal antibody