SIGMAR1 polyclonal antibody
  • SIGMAR1 polyclonal antibody

SIGMAR1 polyclonal antibody

Ref: AB-PAB21642
SIGMAR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SIGMAR1.
Información adicional
Size 100 uL
Gene Name SIGMAR1
Gene Alias FLJ25585|MGC3851|OPRS1|SR-BP1
Gene Description sigma non-opioid intracellular receptor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTY
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SIGMAR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10280
Iso type IgG

Enviar uma mensagem


SIGMAR1 polyclonal antibody

SIGMAR1 polyclonal antibody