SPAG7 polyclonal antibody
  • SPAG7 polyclonal antibody

SPAG7 polyclonal antibody

Ref: AB-PAB21639
SPAG7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPAG7.
Información adicional
Size 100 uL
Gene Name SPAG7
Gene Alias ACRP|FSA-1|MGC20134
Gene Description sperm associated antigen 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ADLLGSILSSMEKPPSLGDQETRRKAREQAARLKKLQEQEKQQKVEFRKRMEKEVSDFIQDSGQIKKKFQPMNKIERSILHDVVEVAG
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPAG7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9552
Iso type IgG

Enviar uma mensagem


SPAG7 polyclonal antibody

SPAG7 polyclonal antibody