C9orf82 polyclonal antibody
  • C9orf82 polyclonal antibody

C9orf82 polyclonal antibody

Ref: AB-PAB21638
C9orf82 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C9orf82.
Información adicional
Size 100 uL
Gene Name C9orf82
Gene Alias FLJ13657|RP11-337A23.1
Gene Description chromosome 9 open reading frame 82
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq STDSSSVSGSLQQETKYILPTLEKELFLAEHSDLEEGGLDLTVSLKPVSFYISDKKEMLQQCFCIIGEKKLQKMLPDVLKNCS
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C9orf82.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79886
Iso type IgG

Enviar uma mensagem


C9orf82 polyclonal antibody

C9orf82 polyclonal antibody