AZI1 polyclonal antibody
  • AZI1 polyclonal antibody

AZI1 polyclonal antibody

Ref: AB-PAB21637
AZI1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AZI1.
Información adicional
Size 100 uL
Gene Name AZI1
Gene Alias AZ1|Cep131
Gene Description 5-azacytidine induced 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq DFLMLFEGSPSGKKRPASLSTAPSEKGATWNVLDDQPRGFTLPSNARSSSALDSPAGPRRKECTVALAPNFTANNRSNKGAVGNCVTTM
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AZI1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22994
Iso type IgG

Enviar uma mensagem


AZI1 polyclonal antibody

AZI1 polyclonal antibody