GOPC polyclonal antibody
  • GOPC polyclonal antibody

GOPC polyclonal antibody

Ref: AB-PAB21636
GOPC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GOPC.
Información adicional
Size 100 uL
Gene Name GOPC
Gene Alias CAL|FIG|GOPC1|PIST|dJ94G16.2
Gene Description golgi associated PDZ and coiled-coil motif containing
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq IEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GOPC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57120
Iso type IgG

Enviar uma mensagem


GOPC polyclonal antibody

GOPC polyclonal antibody