WIPF2 polyclonal antibody
  • WIPF2 polyclonal antibody

WIPF2 polyclonal antibody

Ref: AB-PAB21633
WIPF2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WIPF2.
Información adicional
Size 100 uL
Gene Name WIPF2
Gene Alias WICH|WIRE
Gene Description WAS/WASL interacting protein family, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WIPF2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 147179
Iso type IgG

Enviar uma mensagem


WIPF2 polyclonal antibody

WIPF2 polyclonal antibody