GIGYF1 polyclonal antibody
  • GIGYF1 polyclonal antibody

GIGYF1 polyclonal antibody

Ref: AB-PAB21632
GIGYF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GIGYF1.
Información adicional
Size 100 uL
Gene Name GIGYF1
Gene Alias GYF1|PERQ1
Gene Description GRB10 interacting GYF protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GIQLSPGVGSSAGPPGDLEDDEGLKHLQQEAEKLVASLQDSSLEEEQFTAAMQTQGLRHSAAATALPLSHGAARKWFYKDPQGEIQGPFTTQEMAEWF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GIGYF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64599
Iso type IgG

Enviar uma mensagem


GIGYF1 polyclonal antibody

GIGYF1 polyclonal antibody