ZNF703 polyclonal antibody
  • ZNF703 polyclonal antibody

ZNF703 polyclonal antibody

Ref: AB-PAB21627
ZNF703 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF703.
Información adicional
Size 100 uL
Gene Name ZNF703
Gene Alias FLJ14299|ZNF503L
Gene Description zinc finger protein 703
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF703.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80139
Iso type IgG

Enviar uma mensagem


ZNF703 polyclonal antibody

ZNF703 polyclonal antibody