ARHGAP27 polyclonal antibody
  • ARHGAP27 polyclonal antibody

ARHGAP27 polyclonal antibody

Ref: AB-PAB21625
ARHGAP27 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARHGAP27.
Información adicional
Size 100 uL
Gene Name ARHGAP27
Gene Alias CAMGAP1|FLJ43547|MGC120624
Gene Description Rho GTPase activating protein 27
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WTVLEGGVLTFFKDSKTSAAGGLRQPSKFSTPEYTVELRGATLSWAPKDKSSRKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAQGIQE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARHGAP27.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 201176
Iso type IgG

Enviar uma mensagem


ARHGAP27 polyclonal antibody

ARHGAP27 polyclonal antibody