PSMG3 polyclonal antibody
  • PSMG3 polyclonal antibody

PSMG3 polyclonal antibody

Ref: AB-PAB21614
PSMG3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PSMG3.
Información adicional
Size 100 uL
Gene Name PSMG3
Gene Alias C7orf48|MGC10911|PAC3
Gene Description proteasome (prosome, macropain) assembly chaperone 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PSMG3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84262
Iso type IgG

Enviar uma mensagem


PSMG3 polyclonal antibody

PSMG3 polyclonal antibody