SLC34A3 polyclonal antibody
  • SLC34A3 polyclonal antibody

SLC34A3 polyclonal antibody

Ref: AB-PAB21605
SLC34A3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC34A3.
Información adicional
Size 100 uL
Gene Name SLC34A3
Gene Alias FLJ38680|HHRH|NPTIIc
Gene Description solute carrier family 34 (sodium phosphate), member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKELRVAGRLRRVAGSVLKACG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC34A3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 142680
Iso type IgG

Enviar uma mensagem


SLC34A3 polyclonal antibody

SLC34A3 polyclonal antibody