KIFAP3 polyclonal antibody
  • KIFAP3 polyclonal antibody

KIFAP3 polyclonal antibody

Ref: AB-PAB21604
KIFAP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIFAP3.
Información adicional
Size 100 uL
Gene Name KIFAP3
Gene Alias FLJ22818|KAP3|SMAP|Smg-GDS|dJ190I16.1
Gene Description kinesin-associated protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ELLNAQQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDIIAEYDEEWAKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIFAP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22920
Iso type IgG

Enviar uma mensagem


KIFAP3 polyclonal antibody

KIFAP3 polyclonal antibody