FMO1 polyclonal antibody
  • FMO1 polyclonal antibody

FMO1 polyclonal antibody

Ref: AB-PAB21599
FMO1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FMO1.
Información adicional
Size 100 uL
Gene Name FMO1
Gene Alias -
Gene Description flavin containing monooxygenase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FMO1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2326
Iso type IgG

Enviar uma mensagem


FMO1 polyclonal antibody

FMO1 polyclonal antibody