View larger
Rabbit polyclonal antibody raised against recombinant LRBA.
AB-PAB21593
New product
LRBA polyclonal antibody
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | LRBA |
| Gene Alias | BGL|CDC4L|DKFZp686A09128|DKFZp686K03100|DKFZp686P2258|FLJ16600|FLJ25686|LAB300|LBA|MGC72098 |
| Gene Description | LPS-responsive vesicle trafficking, beach and anchor containing |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | IHC-P |
| Immunogen Prot. Seq | GGWRVWVDTLSITHSKVTFEIHKENLANIFREQQGKVDEEIGLCSSTSVQAASGIRRDINVSVGSQQPDTKDSPVCPHFTTNGNENSSIEKTSSLESASNIELQTTNTSYEEMKAEQENQELPDEGTLEETL |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:200-1:500)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human LRBA. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 987 |
| Iso type | IgG |
More info
Rabbit polyclonal antibody raised against recombinant LRBA.