NARG1 polyclonal antibody
  • NARG1 polyclonal antibody

NARG1 polyclonal antibody

Ref: AB-PAB21591
NARG1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NARG1.
Información adicional
Size 100 uL
Gene Name NARG1
Gene Alias Ga19|NATH|TBDN100
Gene Description NMDA receptor regulated 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ALEHLCTYEKQICDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKG
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NARG1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80155
Iso type IgG

Enviar uma mensagem


NARG1 polyclonal antibody

NARG1 polyclonal antibody