MSL1 polyclonal antibody
  • MSL1 polyclonal antibody

MSL1 polyclonal antibody

Ref: AB-PAB21588
MSL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MSL1.
Información adicional
Size 100 uL
Gene Name MSL1
Gene Alias DKFZp686J17211|MGC141861|MSL-1|hMSL1
Gene Description male-specific lethal 1 homolog (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq FGSTERKTPVKKLAPEFSKVKTKTPKHSPIKEEPCGSLSETVCKRELRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEIEDLPYLSTTEMY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MSL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339287
Iso type IgG

Enviar uma mensagem


MSL1 polyclonal antibody

MSL1 polyclonal antibody