ZNF366 polyclonal antibody
  • ZNF366 polyclonal antibody

ZNF366 polyclonal antibody

Ref: AB-PAB21583
ZNF366 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF366.
Información adicional
Size 100 uL
Gene Name ZNF366
Gene Alias DCSCRIPT|FLJ39796
Gene Description zinc finger protein 366
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DLAVKKTPSFPHCLQPVASRGKAPQRHPFPEALRGPFSQFRYEPPPGDLDGFPGVFEGAGSRKRKSMPTKMPYNH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF366.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 167465
Iso type IgG

Enviar uma mensagem


ZNF366 polyclonal antibody

ZNF366 polyclonal antibody