ZNF566 polyclonal antibody
  • ZNF566 polyclonal antibody

ZNF566 polyclonal antibody

Ref: AB-PAB21574
ZNF566 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF566.
Información adicional
Size 100 uL
Gene Name ZNF566
Gene Alias FLJ14779|MGC12515
Gene Description zinc finger protein 566
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FQCSSFRDDWECNRQFKKELGSQGGHFNQLVFTHEDLPTLSHHPSFTLQQIINSKKKFCASKEYRKTFRHGSQFATHEIIHTIEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF566.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84924
Iso type IgG

Enviar uma mensagem


ZNF566 polyclonal antibody

ZNF566 polyclonal antibody