EFR3A polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant EFR3A.

AB-PAB21570

New product

EFR3A polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name EFR3A
Gene Alias DKFZp781J0562|KIAA0143
Gene Description EFR3 homolog A (S. cerevisiae)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IAVPAFCQHVSKVIEIRTMEAPYFLPEHIFRDKCMLPKSLEKHEKDLYFLTNKIAESLGGSGYSVERLSVPYVPQVTDEDRL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EFR3A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23167
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant EFR3A.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant EFR3A.

Rabbit polyclonal antibody raised against recombinant EFR3A.