FAM166A polyclonal antibody
  • FAM166A polyclonal antibody

FAM166A polyclonal antibody

Ref: AB-PAB21555
FAM166A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM166A.
Información adicional
Size 100 uL
Gene Name FAM166A
Gene Alias FLJ40100|HSD46
Gene Description family with sequence similarity 166, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PGVENIPRQILLPAGFTPDTPHPPCPPGRKGDSRDLGHPVYGEEAWKSATPVCEAPRQHQLYHCQRDEYPPPARRQQETLDVGSFQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM166A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 401565
Iso type IgG

Enviar uma mensagem


FAM166A polyclonal antibody

FAM166A polyclonal antibody