DSCR3 polyclonal antibody
  • DSCR3 polyclonal antibody

DSCR3 polyclonal antibody

Ref: AB-PAB21553
DSCR3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DSCR3.
Información adicional
Size 100 uL
Gene Name DSCR3
Gene Alias DCRA|DSCRA|MGC117385
Gene Description Down syndrome critical region gene 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFIVHSAPQKGKFTPSPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DSCR3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10311
Iso type IgG

Enviar uma mensagem


DSCR3 polyclonal antibody

DSCR3 polyclonal antibody