C17orf81 polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant C17orf81.

AB-PAB21551

New product

C17orf81 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name C17orf81
Gene Alias DERP6|HSPC002|MST071|MSTP071
Gene Description chromosome 17 open reading frame 81
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq GTGRELEMLDSLLALGGLVLLRDSVEWEGRSLLKALVKKSALCGEQVHILGCEVSEEEFREGFDSDINNRL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)<br>Western Blot (1:250-1:500)<br>Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C17orf81.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23587
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant C17orf81.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant C17orf81.

Rabbit polyclonal antibody raised against recombinant C17orf81.