C17orf48 polyclonal antibody
  • C17orf48 polyclonal antibody

C17orf48 polyclonal antibody

Ref: AB-PAB21549
C17orf48 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C17orf48.
Información adicional
Size 100 uL
Gene Name C17orf48
Gene Alias MDS006|NBLA03831
Gene Description chromosome 17 open reading frame 48
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QSSPKYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTFSDTNQEKVVIVSHLPIYP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C17orf48.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56985
Iso type IgG

Enviar uma mensagem


C17orf48 polyclonal antibody

C17orf48 polyclonal antibody