CCDC25 polyclonal antibody
  • CCDC25 polyclonal antibody

CCDC25 polyclonal antibody

Ref: AB-PAB21547
CCDC25 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC25.
Información adicional
Size 100 uL
Gene Name CCDC25
Gene Alias FLJ10853
Gene Description coiled-coil domain containing 25
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SSAYTIYMGKDKYENEDLIKHGWPEDIWFHVDKLSSAHVYLRLHKGENIEDIPKEVLMD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC25.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55246
Iso type IgG

Enviar uma mensagem


CCDC25 polyclonal antibody

CCDC25 polyclonal antibody