MFSD6L polyclonal antibody
  • MFSD6L polyclonal antibody

MFSD6L polyclonal antibody

Ref: AB-PAB21543
MFSD6L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MFSD6L.
Información adicional
Size 100 uL
Gene Name MFSD6L
Gene Alias FLJ35773
Gene Description major facilitator superfamily domain containing 6-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NRVHFPCNGSSGLTSTDALPGVTLPVNITSAQESASSHPAKRTAEVEMPGFRNPPGESDRETFRDLHVYLAPSVEGARTTS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MFSD6L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 162387
Iso type IgG

Enviar uma mensagem


MFSD6L polyclonal antibody

MFSD6L polyclonal antibody