NEFM polyclonal antibody
  • NEFM polyclonal antibody

NEFM polyclonal antibody

Ref: AB-PAB21539
NEFM polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NEFM.
Información adicional
Size 100 uL
Gene Name NEFM
Gene Alias NEF3|NF-M|NFM
Gene Description neurofilament, medium polypeptide
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NEFM.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4741
Iso type IgG

Enviar uma mensagem


NEFM polyclonal antibody

NEFM polyclonal antibody