ZNF677 polyclonal antibody
  • ZNF677 polyclonal antibody

ZNF677 polyclonal antibody

Ref: AB-PAB21534
ZNF677 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF677.
Información adicional
Size 100 uL
Gene Name ZNF677
Gene Alias MGC48625
Gene Description zinc finger protein 677
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NYRNLLSLDEDNIPPEDDISVGFTSKGLSPKENNKEELYHLVILERKESHGINNFDLKEVWENMPKFDSLWDYDVK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF677.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 342926
Iso type IgG

Enviar uma mensagem


ZNF677 polyclonal antibody

ZNF677 polyclonal antibody