MLXIP polyclonal antibody
  • MLXIP polyclonal antibody

MLXIP polyclonal antibody

Ref: AB-PAB21531
MLXIP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MLXIP.
Información adicional
Size 100 uL
Gene Name MLXIP
Gene Alias KIAA0867|MIR|MONDOA|bHLHe36
Gene Description MLX interacting protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LKREGMLASTVSQSNVVIAPAAIARAPGVPEFHSSILVTDLGHGTSSPPAPVSRLFPSTAQDPLGKGEQVPLHGGSPQVTVTGPSRDCPNSGQASPCASEQSPSPQSPQNNCSGKSDPKNVAALKNRQMK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MLXIP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22877
Iso type IgG

Enviar uma mensagem


MLXIP polyclonal antibody

MLXIP polyclonal antibody