SLFN13 polyclonal antibody
  • SLFN13 polyclonal antibody

SLFN13 polyclonal antibody

Ref: AB-PAB21529
SLFN13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLFN13.
Información adicional
Size 100 uL
Gene Name SLFN13
Gene Alias DKFZp666J196|DKFZp686I026|FLJ31952|SLFN10
Gene Description schlafen family member 13
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YCRSGTSVLHMNSRQAFDFLKTKERQSKYNLINEGSPPSKIMKAVYQNISESNPAYEVFQTDTIEYGEILSFPESPSIE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLFN13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 146857
Iso type IgG

Enviar uma mensagem


SLFN13 polyclonal antibody

SLFN13 polyclonal antibody