CHMP6 polyclonal antibody
  • CHMP6 polyclonal antibody

CHMP6 polyclonal antibody

Ref: AB-PAB21516
CHMP6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHMP6.
Información adicional
Size 100 uL
Gene Name CHMP6
Gene Alias FLJ11749|VPS20
Gene Description chromatin modifying protein 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MGNLFGCKKQSRVTEQDKAILQLKQQRDKLRQYQKRIAQQLERERALARQLLRDGRKERAKLLLKKKRYQEQLLDRTENQISSLEAMVQSIEFTQIEMKV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHMP6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79643
Iso type IgG

Enviar uma mensagem


CHMP6 polyclonal antibody

CHMP6 polyclonal antibody