CCDC144A polyclonal antibody
  • CCDC144A polyclonal antibody

CCDC144A polyclonal antibody

Ref: AB-PAB21515
CCDC144A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC144A.
Información adicional
Size 100 uL
Gene Name CCDC144A
Gene Alias FLJ43983|KIAA0565|MGC164650
Gene Description coiled-coil domain containing 144A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MESYRCRLAAAVRDCDQSQTARDLKLDFQRTRQEWVRLHDKMKVDMSGLQAKNEILSEKLSNAESKINSLQIQLHNTRDALGRESLILERVQRDLSQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC144A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9720
Iso type IgG

Enviar uma mensagem


CCDC144A polyclonal antibody

CCDC144A polyclonal antibody