EFR3A polyclonal antibody
  • EFR3A polyclonal antibody

EFR3A polyclonal antibody

Ref: AB-PAB21510
EFR3A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EFR3A.
Información adicional
Size 100 uL
Gene Name EFR3A
Gene Alias DKFZp781J0562|KIAA0143
Gene Description EFR3 homolog A (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NTSSKDNDEKIVQNAIIQTIGFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLDISQLGDLGTRRIQIMLL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EFR3A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23167
Iso type IgG

Enviar uma mensagem


EFR3A polyclonal antibody

EFR3A polyclonal antibody