NIPA1 polyclonal antibody
  • NIPA1 polyclonal antibody

NIPA1 polyclonal antibody

Ref: AB-PAB21503
NIPA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NIPA1.
Información adicional
Size 100 uL
Gene Name NIPA1
Gene Alias FSP3|MGC102724|MGC35570|SPG6
Gene Description non imprinted in Prader-Willi/Angelman syndrome 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HGPTNIMVYISICSLLGSFTVPSTKGIGLAAQDILHNNPSSQRA
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NIPA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 123606
Iso type IgG

Enviar uma mensagem


NIPA1 polyclonal antibody

NIPA1 polyclonal antibody