View larger
Rabbit polyclonal antibody raised against recombinant NIPA1.
AB-PAB21503
New product
NIPA1 polyclonal antibody
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | NIPA1 |
| Gene Alias | FSP3|MGC102724|MGC35570|SPG6 |
| Gene Description | non imprinted in Prader-Willi/Angelman syndrome 1 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | IHC-P |
| Immunogen Prot. Seq | HGPTNIMVYISICSLLGSFTVPSTKGIGLAAQDILHNNPSSQRA |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:10-1:20)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human NIPA1. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 123606 |
| Iso type | IgG |
More info
Rabbit polyclonal antibody raised against recombinant NIPA1.