ZNF462 polyclonal antibody
  • ZNF462 polyclonal antibody

ZNF462 polyclonal antibody

Ref: AB-PAB21489
ZNF462 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF462.
Información adicional
Size 100 uL
Gene Name ZNF462
Gene Alias DKFZp686B2325|DKFZp762N2316|FLJ14960|FLJ45904|KIAA1803|RP11-508N12.1|Zfp462
Gene Description zinc finger protein 462
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HGAALNTEKRFPCEFCGRAFSQGSEWERHVLRHGMALNDTKQVSREEIHPKEIMENSVKMPSIEEKEDDEAIGIDFSLKNETVAICVVTA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF462.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 58499
Iso type IgG

Enviar uma mensagem


ZNF462 polyclonal antibody

ZNF462 polyclonal antibody