PERP polyclonal antibody
  • PERP polyclonal antibody

PERP polyclonal antibody

Ref: AB-PAB21486
PERP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PERP.
Información adicional
Size 100 uL
Gene Name PERP
Gene Alias KCP1|KRTCAP1|PIGPC1|RP3-496H19.1|THW|dJ496H19.1
Gene Description PERP, TP53 apoptosis effector
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PERP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64065
Iso type IgG

Enviar uma mensagem


PERP polyclonal antibody

PERP polyclonal antibody