OLFML2A polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant OLFML2A.

AB-PAB21484

New product

OLFML2A polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name OLFML2A
Gene Alias FLJ00237|PRO34319
Gene Description olfactomedin-like 2A
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQSMVDLLEGTLYSMDLMKVHAYVHKVASQMNTLEESIKANLSREN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OLFML2A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 169611
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant OLFML2A.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant OLFML2A.

Rabbit polyclonal antibody raised against recombinant OLFML2A.