NYAP1 polyclonal antibody
  • NYAP1 polyclonal antibody

NYAP1 polyclonal antibody

Ref: AB-PAB21483
NYAP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NYAP1.
Información adicional
Size 100 uL
Gene Name NYAP1
Gene Alias C7orf51|KIAA1486L
Gene Description neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adaptor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WTYPATAAGLKRPPAYESLKAGGVLNKGCGVGAPSPMVKIQLQEQGTDGGAFASISCAHVIASAGTPEEEEEEVGAATFGAGWALQRKVLYGGRKAKELD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NYAP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 222950
Iso type IgG

Enviar uma mensagem


NYAP1 polyclonal antibody

NYAP1 polyclonal antibody