RSAD1 polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant RSAD1.

AB-PAB21475

New product

RSAD1 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name RSAD1
Gene Alias FLJ11164|FLJ20975
Gene Description radical S-adenosyl methionine domain containing 1
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VTLEANPTSAPGSRLAEFGAAGVNRLSIGLQSLDDTELRLLGRTHSACDALRTLAEARRLFPGRVSVDLMLGLPAQQVGPWLGQLQELLHHC
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RSAD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55316
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant RSAD1.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant RSAD1.

Rabbit polyclonal antibody raised against recombinant RSAD1.