ABCA5 polyclonal antibody
  • ABCA5 polyclonal antibody

ABCA5 polyclonal antibody

Ref: AB-PAB21472
ABCA5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ABCA5.
Información adicional
Size 100 uL
Gene Name ABCA5
Gene Alias ABC13|DKFZp451F117|DKFZp779N2435|EST90625|FLJ16381
Gene Description ATP-binding cassette, sub-family A (ABC1), member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PNKKYEEVPNIELNPMDKFTLSNLILGYTPVTNITSSIMQKVSTDHLPDVIITEEYTNEKEMLTSSLSKPSNFV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ABCA5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23461
Iso type IgG

Enviar uma mensagem


ABCA5 polyclonal antibody

ABCA5 polyclonal antibody