NOL11 polyclonal antibody
  • NOL11 polyclonal antibody

NOL11 polyclonal antibody

Ref: AB-PAB21468
NOL11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NOL11.
Información adicional
Size 100 uL
Gene Name NOL11
Gene Alias DKFZp586L0724
Gene Description nucleolar protein 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq FTLSSVVLSAGPEGLLGVEQSDKTDQFLVTDSGRTVILYKVSDQKPLGSWSVKQGQIITCPAVCNFQTGEYVVVHDNKVLRIWNNEDVNL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NOL11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25926
Iso type IgG

Enviar uma mensagem


NOL11 polyclonal antibody

NOL11 polyclonal antibody