MFSD11 polyclonal antibody
  • MFSD11 polyclonal antibody

MFSD11 polyclonal antibody

Ref: AB-PAB21467
MFSD11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MFSD11.
Información adicional
Size 100 uL
Gene Name MFSD11
Gene Alias ET|FLJ20226|FLJ22196
Gene Description major facilitator superfamily domain containing 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DSENVLGEDESSDDQDMEVNESAQNNLTKAVDAFKKSFKLCVTKEML
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MFSD11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79157
Iso type IgG

Enviar uma mensagem


MFSD11 polyclonal antibody

MFSD11 polyclonal antibody