SLC47A1 polyclonal antibody
  • SLC47A1 polyclonal antibody

SLC47A1 polyclonal antibody

Ref: AB-PAB21466
SLC47A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC47A1.
Información adicional
Size 100 uL
Gene Name SLC47A1
Gene Alias FLJ10847|MATE1|MGC64822
Gene Description solute carrier family 47, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC47A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55244
Iso type IgG

Enviar uma mensagem


SLC47A1 polyclonal antibody

SLC47A1 polyclonal antibody