NAT16 polyclonal antibody
  • NAT16 polyclonal antibody

NAT16 polyclonal antibody

Ref: AB-PAB21464
NAT16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NAT16.
Información adicional
Size 100 uL
Gene Name NAT16
Gene Alias C7orf52
Gene Description N-acetyltransferase 16 (GCN5-related, putative)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LESVNVIDAGETVLVEGLRVAPWERGKGVAGLLQRFCSQLVKRQHPGVKVARLTRDDQLGPRELKKYRLITKQG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NAT16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 375607
Iso type IgG

Enviar uma mensagem


NAT16 polyclonal antibody

NAT16 polyclonal antibody