NAT16 polyclonal antibody  View larger

Rabbit polyclonal antibody raised against recombinant NAT16.

AB-PAB21464

New product

NAT16 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name NAT16
Gene Alias C7orf52
Gene Description N-acetyltransferase 16 (GCN5-related, putative)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LESVNVIDAGETVLVEGLRVAPWERGKGVAGLLQRFCSQLVKRQHPGVKVARLTRDDQLGPRELKKYRLITKQG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NAT16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 375607
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant NAT16.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant NAT16.

Rabbit polyclonal antibody raised against recombinant NAT16.