MKS1 polyclonal antibody
  • MKS1 polyclonal antibody

MKS1 polyclonal antibody

Ref: AB-PAB21454
MKS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MKS1.
Información adicional
Size 100 uL
Gene Name MKS1
Gene Alias BBS13|FLJ20345|MES|MKS
Gene Description Meckel syndrome, type 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TCTTKSLAMDKVAHFSYPFTFEAFFLHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGSHTLTVSTWRPVELGTVA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MKS1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54903
Iso type IgG

Enviar uma mensagem


MKS1 polyclonal antibody

MKS1 polyclonal antibody